General Information

  • ID:  hor002903
  • Uniprot ID:  Q9VU58
  • Protein name:  Neuropeptide-like peptide 2
  • Gene name:  Nplp2
  • Organism:  Drosophila melanogaster (Fruit fly)
  • Family:  NA
  • Source:  animal
  • Expression:  By bacterial infection (at protein level). |Hemolymph (at protein level).
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  melanogaster subgroup, melanogaster group, Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0006959 humoral immune response; GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  TKAQGDFNEF
  • Length:  10(35-44)
  • Propeptide:  MAKLAICILVFALFALALSARVPREESNPAQEFLTKAQGDFNEFIEKLKALDAKKVEGLFKDGLNTVQEGLQKLNETFLQAPAAST
  • Signal peptide:  MAKLAICILVFALFALALS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9VU58-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002903_AF2.pdbhor002903_ESM.pdb

Physical Information

Mass: 131693 Formula: C51H73N13O18
Absent amino acids: CHILMPRSVWY Common amino acids: F
pI: 4.18 Basic residues: 1
Polar residues: 3 Hydrophobic residues: 3
Hydrophobicity: -116 Boman Index: -2712
Half-Life: 7.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 10
Instability Index: 146 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  12171930
  • Title:  Peptidomics of the Larval Drosophila Melanogaster Central Nervous System.
  • PubMed ID:  14690519
  • Title:  Expression of a novel neuropeptide, NVGTLARDFQLPIPNamide, in the larval and adult brain of Drosophila melanogaster.